быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ZC3H12D Rabbit pAb (A17881)
- Описание
- Характеристики
-
Overview
Product name ZC3H12D Rabbit pAb Catalog No. A17881 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Predicted to enable endoribonuclease activity and mRNA binding activity. Involved in negative regulation of G1/S transition of mitotic cell cycle and negative regulation of cell growth. Located in P-body and nucleoplasm.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 150-230 of human ZC3H12D (NP_997243.2). Sequence QHVLAELERQAVLVYTPSRKVHGKRLVCYDDRYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDRFMP Gene ID Swiss Prot Synonyms TFL; p34; MCPIP4; C6orf95; dJ281H8.1 Calculated MW 58kDa Observed MW 70kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples U-87MG, THP-1, Mouse spleen, Mouse liver, Rat spleen Cellular location cytoplasm, cytoplasmic ribonucleoprotein granule, nucleoplasm, nucleus, P-body 
Western blot analysis of extracts of various cell lines, using ZC3H12D antibody (A17881) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of NIH/3T3 cells using ZC3H12D Rabbit pAb (A17881) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 150-230 of human ZC3H12D (NP_997243.2). Isotype IgG