быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ABTB1 Rabbit pAb (A18499)
- Описание
- Характеристики
-
Overview
Product name ABTB1 Rabbit pAb Catalog No. A18499 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a protein with an ankyrin repeat region and two BTB/POZ domains, which are thought to be involved in protein-protein interactions. Expression of this gene is activated by the phosphatase and tensin homolog, a tumor suppressor. Alternate splicing results in three transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ABTB1 (NP_742024.1). Sequence MDTSDLFASCRKGDVGRVRYLLEQRDVEVNVRDKWDSTPLYYACLCGHEELVLYLLANGARCEANTFDGERCLYGALSDPIRRALRDYKQVTASCRRRDYYDDFLQRLLEQGIHSDVVFVVHGKPFRVHRCVLGARSAYF Gene ID Swiss Prot Synonyms BPOZ; BTB3; BTBD21; EF1ABP; PP2259 Calculated MW 54kDa Observed MW 55kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse skeletal muscle, Rat skeletal muscle Cellular location cytoplasm, cytosol, nucleolus, plasma membrane 
Western blot analysis of extracts of various cell lines, using ABTB1 antibody (A18499) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ABTB1 (NP_742024.1). Isotype IgG