быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ZNF645 Rabbit pAb (A18553)
- Описание
- Характеристики
-
Overview
Product name ZNF645 Rabbit pAb Catalog No. A18553 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the zinc finger domain-containing protein family. This family member contains both a RING-type and a C2H2-type of zinc finger domain, and it may function as an E3 ubiquitin-protein ligase. Protein localization suggests a role in human sperm production and quality control.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 346-425 of human ZNF645 (NP_689790.1). Sequence QNGNPSASEFASHHYNLNILPQFTENQETLSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRSHHSHQRRHRRY Gene ID Swiss Prot Synonyms CT138; HAKAIL; ZNF645 Calculated MW 49kDa Observed MW 49kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse testis, Rat testis Cellular location cytoplasm 
Western blot analysis of extracts of various cell lines, using ZNF645 Rabbit pAb (A18553) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 346-425 of human ZNF645 (NP_689790.1). Isotype IgG