быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ZSCAN4C Rabbit pAb (A10205)
- Описание
- Характеристики
-
Overview
Product name ZSCAN4C Rabbit pAb Catalog No. A10205 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Acts upstream of or within negative regulation of mitotic recombination; regulation of transcription by RNA polymerase II; and telomere maintenance via telomere lengthening. Located in chromosome, telomeric region; cytoplasm; and nucleus. Is expressed in 1-cell stage embryo; 2-cell stage embryo; primary oocyte; and secondary oocyte. Orthologous to human ZSCAN4 (zinc finger and SCAN domain containing 4).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-506 of mouse ZSCAN4 (NP_001013787.1). Sequence CSRMFKHARSLSSHQRTHLNKKSELLCVTCQKMFKRVSDRRTHEIIHMPEKPFKCSTCEKSFSHKTNLKSHEMIHTGEMPYVCSLCSRRFRQSSTYHRHLRNYHRSD Gene ID Swiss Prot Synonyms Gm397; Zscan4d; XM_142517 Calculated MW 57kDa Observed MW 57kDa Applications
Reactivity Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse kidney Cellular location Chromosome, Nucleus, telomere 
Western blot analysis of extracts of mouse kidney, using ZSCAN4 antibody (A10205) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-506 of mouse ZSCAN4 (NP_001013787.1). Isotype IgG