быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ZIP8 Rabbit pAb (A10395)
- Описание
- Характеристики
-
Overview
Product name ZIP8 Rabbit pAb Catalog No. A10395 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import of zinc at the onset of inflammation. It is also thought to be the primary transporter of the toxic cation cadmium, which is found in cigarette smoke. Multiple transcript variants encoding different isoforms have been found for this gene. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 180-300 of human ZIP8 (NP_071437.3). Sequence QLIPEAFGFDPKVDSYVEKAVAVFGGFYLLFFFERMLKMLLKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCLKGPKLSEI Gene ID Swiss Prot Synonyms ZIP8; CDG2N; PP3105; BIGM103; LZT-Hs6 Calculated MW 50kDa Observed MW 50kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HL-60, NCI-H460, HeLa, Mouse liver Cellular location Membrane, Multi-pass membrane protein Customer validation WB(Bos taurus)
WB，IP(Homo sapiens，Mus musculus)
Western blot analysis of extracts of various cell lines, using ZIP8 antibody (A10395) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of L929 cells using ZIP8 Rabbit pAb (A10395) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 180-300 of human ZIP8 (NP_071437.3). Isotype IgG