быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
14-3-3 epsilon Rabbit pAb (A1058)
- Описание
- Характеристики
-
Overview
Product name 14-3-3 epsilon Rabbit pAb Catalog No. A1058 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer. Two transcript variants, one protein-coding and the other non-protein-coding, have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 73-163 of human 14-3-3 epsilon (NP_006752.1). Sequence KGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTEL Gene ID Swiss Prot Synonyms MDS; HEL2; MDCR; KCIP-1; 14-3-3E Calculated MW 29kDa Observed MW 29-32Kda Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, 293T, U-251MG, Mouse brain, Mouse kidney, Mouse lung, Rat brain, Rat kidney, Rat lung Cellular location Cytoplasm, Melanosome Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using 14-3-3 epsilon antibody (A1058) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of H9C2 cells using 14-3-3 epsilon antibody (A1058) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of L929 cells using 14-3-3 epsilon antibody (A1058) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using 14-3-3 epsilon antibody (A1058) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 73-163 of human 14-3-3 epsilon (NP_006752.1). Isotype IgG