[KD Validated] MTMR3 Rabbit pAb (A10806)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KD Validated] MTMR3 Rabbit pAb
Catalog No.	A10806
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the myotubularin dual specificity protein phosphatase gene family. The encoded protein is structurally similar to myotubularin but in addition contains a FYVE domain and an N-terminal PH-GRAM domain. The protein can self-associate and also form heteromers with another myotubularin related protein. The protein binds to phosphoinositide lipids through the PH-GRAM domain, and can hydrolyze phosphatidylinositol(3)-phosphate and phosphatidylinositol(3, 5)-biphosphate in vitro. The encoded protein has been observed to have a perinuclear, possibly membrane-bound, distribution in cells, but it has also been found free in the cytoplasm. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 640-810 of human MTMR3 (NP_066576.1).
Sequence	KWQEHRRSLELSSLAGPGEDPLSADSLGKPTRVPGGAELSVAAGVAEGQMENILQEATKEESGVEEPAHRAGIEIQEGKEDPLLEKESRRKTPEASAIGLHQDPELGDAALRSHLDMSWPLFSQGISEQQSGLSVLLSSLQVPPRGEDSLEVPVEQFRIEEIAEGREEAVL
Gene ID
Swiss Prot
Synonyms	ZFYVE10; FYVE-DSP1
Calculated MW	134kDa
Observed MW	130-150kDa

Applications

Reactivity	Human
Tested applications	WB
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T(KD)
Cellular location	Cytoplasm, Membrane, Peripheral membrane protein
Customer validation	WB(Gallus gallus)

Western blot analysis of extracts from wild type(WT) and MTMR3 knockdown (KD) 293T(KD) cells, using MTMR3 Rabbit pAb (A10806) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Key applications	Western blotting
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 640-810 of human MTMR3 (NP_066576.1).
Isotype	IgG