быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ZNF433 Rabbit pAb (A14972)
- Описание
- Характеристики
-
Overview
Product name ZNF433 Rabbit pAb Catalog No. A14972 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II transcription regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be active in nucleus.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 564-673 of human ZNF433 (NP_001073880.1). Sequence CKQCGKAFGSASHLQMHGRTHTGEKPYECKQCGKSFGCASRLQMHGRTHTGEKPYKCKQCGKAFGCPSNLRRHGRTHTGEKPYKCNQCGKVFRCSSQLQVHGRAHCIDTP Gene ID Swiss Prot Synonyms ZNF433 Calculated MW 77kDa Observed MW Applications
Reactivity Human, Mouse, Rat Tested applications IHC-P IF/ICC Recommended dilution - IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Immunohistochemistry Immunofluorescence Positive samples Cellular location Nucleus 
Immunohistochemistry analysis of paraffin-embedded rat brain using ZNF433 antibody (A14972) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human gastric cancer using ZNF433 antibody (A14972) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using ZNF433 antibody (A14972) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of C6 cells using ZNF433 Polyclonal Antibody (A14972) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using ZNF433 Polyclonal Antibody (A14972) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using ZNF433 Polyclonal Antibody (A14972) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 564-673 of human ZNF433 (NP_001073880.1). Isotype IgG