быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ZNF701 Rabbit pAb (A16133)
- Описание
- Характеристики
-
Overview
Product name ZNF701 Rabbit pAb Catalog No. A16133 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be active in nucleus.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ZNF701 (NP_060730.2). Sequence QWQENETNGHEALMTKTKKLMSSTERHDQRHAGNKPIKNELGSSFHSHLPEVHIFHPEGKIGNQVEKAINDAFSVSASQRISCRPKTRISNKYRNNFLQSS Gene ID Swiss Prot Synonyms ZNF701 Calculated MW 61kDa Observed MW 54kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:2000 - 1:10000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples K-562, MCF7, Raji Cellular location Nucleus 
Western blot analysis of various lysates, using ZNF701 antibody (A16133) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ZNF701 (NP_060730.2). Isotype IgG