быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ZNF471 Rabbit pAb (A16560)
- Описание
- Характеристики
-
Overview
Product name ZNF471 Rabbit pAb Catalog No. A16560 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Located in nucleus.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-210 of human ZNF471 (NP_065864.2). Sequence TRSPFSDWESIYVTQELPLKQFMYDDACMEGITSYGLECSTFEENWKWEDLFEKQMGSHEMFSKKEIITHKETITKETEFKYTKFGKCIHLENIEESIYNHTSDKKSFSKNSMVIKHKKVYVGKKLFKCNE Gene ID Swiss Prot Synonyms ERP1; Z1971; Zfp78 Calculated MW 73kDa Observed MW 90kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse pancreas, Mouse skeletal muscle, Mouse brain, Rat pancreas, Rat skeletal muscle, Rat brain Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using ZNF471 antibody (A16560) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-210 of human ZNF471 (NP_065864.2). Isotype IgG