быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ZNF76 Rabbit pAb (A16627)
- Описание
- Характеристики
-
Overview
Product name ZNF76 Rabbit pAb Catalog No. A16627 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Enables DNA-binding transcription activator activity, RNA polymerase II-specific and sequence-specific double-stranded DNA binding activity. Involved in positive regulation of transcription by RNA polymerase II. Predicted to be located in nucleus.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-170 of human ZNF76 (NP_003418.2). Sequence HPVAVPSESTILAVQTEVGLEDLAAEDDEGFSADAVVALEQYASKVLHDSQIPRNGKGQQVGDRAFRCGYK Gene ID Swiss Prot Synonyms ZNF523; Zfp523; D6S229E Calculated MW 62kDa Observed MW 61kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, Mouse testis, Rat serum Cellular location nucleus Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using ZNF76 antibody (A16627) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-170 of human ZNF76 (NP_003418.2). Isotype IgG