быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ZSCAN1 Rabbit pAb (A16639)
- Описание
- Характеристики
-
Overview
Product name ZSCAN1 Rabbit pAb Catalog No. A16639 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be located in nucleus. Predicted to be part of chromatin.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ZSCAN1 (NP_872378.3). Sequence VFTWVTHFIEHQKTHREEGPFPCPECGKVFLHNSVLTEHGKIHLLEPPRKKAPRSKGPRESVPPRDGAQGPVAPRSPKRPFQCSVCGKAFPWMVHLIDHQK Gene ID Swiss Prot Synonyms MZF-1; ZNF915 Calculated MW 45kDa Observed MW 45kDa/62kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, T-47D Cellular location nucleus 
Western blot analysis of 293T-ZSCAN1, using ZSCAN1 Rabbit pAb (A16639) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Western blot analysis of T-47D, using ZSCAN1 Rabbit pAb (A16639) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ZSCAN1 (NP_872378.3). Isotype IgG