- 100 μL
- 200 μL
- 50 μL
- Описание
- Характеристики
-
Overview
Product name α-Smooth Muscle Actin (ACTA2) Rabbit pAb Catalog No. A7248 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a smooth muscle actin that is involved in vascular contractility and blood pressure homeostasis. Mutations in this gene cause a variety of vascular diseases, such as thoracic aortic disease, coronary artery disease, stroke, and Moyamoya disease, as well as multisystemic smooth muscle dysfunction syndrome.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human α-Smooth Muscle Actin (ACTA2) (NP_001604.1). Sequence MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAP Gene ID Swiss Prot Synonyms ACTSA Calculated MW 42kDa Observed MW 42kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:20 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse heart Cellular location Cytoplasm, cytoskeleton Customer validation WB(Homo sapiens, Mus musculus, Zea mays, Rattus norvegicus)
IF(Homo sapiens, Mus musculus)
IF(Mus musculus, Rattus norvegicus)
IHC(Mus musculus, Rattus norvegicus)
WB(Mus musculus)
IHC(Rattus norvegicus)
IHC(Mus musculus)

Western blot analysis of Mouse heart, using α-SmoothMuscleActin(ACTA2) antibody (A7248) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of various lysates, using Smooth Muscle Actin(SMA) Rabbit pAb (A7248) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded human colon using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human placenta using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat lung using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human α-Smooth Muscle Actin (ACTA2) (NP_001604.1). Isotype IgG







