быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ABCA6 Rabbit pAb (A3191)
- Описание
- Характеристики
-
Overview
Product name ABCA6 Rabbit pAb Catalog No. A3191 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Predicted to enable ATPase-coupled transmembrane transporter activity and lipid transporter activity. Predicted to be involved in lipid transport. Predicted to be located in Golgi membrane; nucleoplasm; and plasma membrane. Predicted to be active in intracellular membrane-bounded organelle. Is expressed in tail. Orthologous to human ABCA6 (ATP binding cassette subfamily A member 6).Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 690-828 of human ABCA6 (NP_525023.2). Sequence RLKCAGSSMFLKRRWGLGYHLSLHRNEICNPEQITSFITHHIPDAKLKTENKEKLVYTLPLERTNTFPDLFSDLDKCSDQGVTGYDISMSTLNEVFMKLEGQSTIEQDFEQVEMIRDSESLNEMELAHSSFSEMQTAVS Gene ID Swiss Prot Synonyms 6330565N06Rik Calculated MW 44kDa/183kDa Observed MW 185kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:100 - 1:500
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse liver, Rat liver Cellular location Membrane, Multi-pass membrane protein Customer validation WB(Mus musculus)
Western blot analysis of extracts of various cell lines, using (A3191) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s. -
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 690-828 of human ABCA6 (NP_525023.2). Isotype IgG