быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
β-Catenin Rabbit pAb (A0316)
- Описание
- Характеристики
-
Overview
Product name β-Catenin Rabbit pAb Catalog No. A0316 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human β-Catenin (NP_001895.1). Sequence GVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPV Gene ID Swiss Prot Synonyms EVR7; CTNNB; MRD19; NEDSDV; armadillo Calculated MW 85kDa Observed MW 100kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P IP Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Positive samples Mouse lung, Mouse brain Cellular location Cell junction, Cell membrane, Cytoplasm, Nucleus, adherens junction, centrosome, cytoskeleton, microtubule organizing center, spindle pole Customer validation WB(Homo sapiens, Rattus norvegicus, Mus musculus)
ICC(Homo sapiens)
Western blot analysis of extracts of Mouse lung, using β-Catenin antibody (A0316) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded Human breast cancer using β-Catenin antibody (A0316) at dilution of 20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human pancreas using β-Catenin antibody (A0316) at dilution of 20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human small cell lung cancer using β-Catenin antibody (A0316) at dilution of 20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunoprecipitation analysis of 600 μg extracts of Mouse brain using 3 μg β-Catenin antibody (A0316). Western blot was performed from the immunoprecipitate using β-Catenin antibody (A0316) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human β-Catenin (NP_001895.1). Isotype IgG