![[KD Validated] RhoA Rabbit pAb (A18695)](/upload/resize_cache/iblock/e43/340_340_140cd750bba9870f18aada2478b24840a/np2fmu53keys0vpzh2jpik27usc11ayi.jpg "[KD Validated] RhoA Rabbit pAb (A18695)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KD Validated] RhoA Rabbit pAb (A18695)
- Описание
- Характеристики
-
Overview
Product name [KD Validated] RhoA Rabbit pAb Catalog No. A18695 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 94-193 of human RhoA (NP_001655.1). Sequence NIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL Gene ID Swiss Prot Synonyms ARHA; ARH12; RHO12; EDFAOB; RHOH12 Calculated MW 22kDa Observed MW 22kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, HUVEC, PC-12, Mouse brain Cellular location Cell membrane, Cell projection, Cleavage furrow, Cytoplasm, Cytoplasmic side, Lipid-anchor, Midbody, cell cortex, cytoskeleton, lamellipodium 
Western blot analysis of various lysates, using RhoA antibody (A18695) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of Mouse brain, using RhoA antibody (A18695) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of extracts from wild type(WT) and RhoA knockdown (KD) HeLa(KD) cells, using RhoA antibody (A18695) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 94-193 of human RhoA (NP_001655.1). Isotype IgG