быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
ZFP36 Rabbit pAb (A1878)
- Описание
- Характеристики
-
Overview
Product name ZFP36 Rabbit pAb Catalog No. A1878 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Enables several functions, including 14-3-3 protein binding activity; heat shock protein binding activity; and mRNA 3'-UTR AU-rich region binding activity. Involved in several processes, including cellular response to cytokine stimulus; cellular response to growth factor stimulus; and regulation of gene expression. Acts upstream of or within mRNA catabolic process. Located in cytoplasmic ribonucleoprotein granule; cytosol; and nucleus. Part of ribonucleoprotein complex. Colocalizes with RISC-loading complex.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 230-326 of human ZFP36 (NP_003398.3). Sequence SAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE Gene ID Swiss Prot Synonyms TTP; G0S24; GOS24; TIS11; NUP475; zfp-36; RNF162A Calculated MW 34kDa Observed MW 29kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples WiDr Cellular location Cytoplasm, Nucleus Customer validation WB(Homo sapiens)
Western blot analysis of extracts of WiDr cells, using ZFP36 antibody (A1878).
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 230-326 of human ZFP36 (NP_003398.3). Isotype IgG