![[KD Validated] RARG Rabbit pAb (A21785)](/upload/resize_cache/iblock/931/340_340_140cd750bba9870f18aada2478b24840a/7mma2e8gzxwq80h4w2wkspg3wy4jthuz.jpg "[KD Validated] RARG Rabbit pAb (A21785)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KD Validated] RARG Rabbit pAb (A21785)
- Описание
- Характеристики
-
Overview
Product name [KD Validated] RARG Rabbit pAb Catalog No. A21785 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a retinoic acid receptor that belongs to the nuclear hormone receptor family. Retinoic acid receptors (RARs) act as ligand-dependent transcriptional regulators. When bound to ligands, RARs activate transcription by binding as heterodimers to the retinoic acid response elements (RARE) found in the promoter regions of the target genes. In their unbound form, RARs repress transcription of their target genes. RARs are involved in various biological processes, including limb bud development, skeletal growth, and matrix homeostasis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human RARG (NP_000957.1). Sequence MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSS Gene ID Swiss Prot Synonyms RARC; NR1B3; RARgamma Calculated MW 50kDa Observed MW 48kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples MCF7, SK-BR-3 Cellular location Nucleus 
Western blot analysis of extracts of SK-BR-3 cells, using RARG antibody (A21785) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
Western blot analysis of extracts from wild type (WT) and RARG knockdown (KD) MCF7 cells, using RARG antibody (A21785) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human RARG (NP_000957.1). Isotype IgG