![[KD Validated] ISG15 Rabbit pAb (A21995)](/upload/resize_cache/iblock/8ad/340_340_140cd750bba9870f18aada2478b24840a/8clisb1xb1k0o7f6spzihu307lwjf8xv.jpg "[KD Validated] ISG15 Rabbit pAb (A21995)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KD Validated] ISG15 Rabbit pAb (A21995)
- Описание
- Характеристики
-
Overview
Product name [KD Validated] ISG15 Rabbit pAb Catalog No. A21995 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human ISG15 (NP_005092.1). Sequence MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS Gene ID Swiss Prot Synonyms G1P2; IP17; UCRP; IFI15; IMD38; hUCRP Calculated MW 18kDa Observed MW 15kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa Cellular location cytoplasm, cytosol, extracellular region, nucleoplasm, nucleus 
Western blot analysis of extracts from wild type(WT) and ISG15 Rabbit pAb knockdown (KD) HeLa cells, using ISG15 Rabbit pAb antibody (A21995) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human ISG15 (NP_005092.1). Isotype IgG