![[KD Validated] SFRP2 Rabbit pAb (A22017)](/upload/resize_cache/iblock/2c5/340_340_140cd750bba9870f18aada2478b24840a/m7dg08sha00zfvxi8m5ljctv06sbnp5k.jpg "[KD Validated] SFRP2 Rabbit pAb (A22017)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KD Validated] SFRP2 Rabbit pAb (A22017)
- Описание
- Характеристики
-
Overview
Product name [KD Validated] SFRP2 Rabbit pAb Catalog No. A22017 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the presence of colorectal cancer.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SFRP2 (NP_003004.1). Sequence MLQGPGSLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFA Gene ID Swiss Prot Synonyms FRP-2; SARP1; SDF-5 Calculated MW 33kDa Observed MW 33kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa Cellular location extracellular space 
Western blot analysis of extracts from wild type(WT) and SFRP2 knockdown (KD) HeLa cells, using SFRP2 antibody (A22017) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of A431 cells using [KD Validated] SFRP2 Rabbit pAb (A22017) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using [KD Validated] SFRP2 Rabbit pAb (A22017) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using [KD Validated] SFRP2 Rabbit pAb (A22017) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SFRP2 (NP_003004.1). Isotype IgG