быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KD Validated] MT2A Rabbit pAb (A22103)
- Описание
- Характеристики
-
Overview
Product name [KD Validated] MT2A Rabbit pAb Catalog No. A22103 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene is a member of the metallothionein family of genes. Proteins encoded by this gene family are low in molecular weight, are cysteine-rich, lack aromatic residues, and bind divalent heavy metal ions, altering the intracellular concentration of heavy metals in the cell. These proteins act as anti-oxidants, protect against hydroxyl free radicals, are important in homeostatic control of metal in the cell, and play a role in detoxification of heavy metals. The encoded protein interacts with the protein encoded by the homeobox containing 1 gene in some cell types, controlling intracellular zinc levels, affecting apoptotic and autophagy pathways. Some polymorphisms in this gene are associated with an increased risk of cancer.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-61 of human MT2A (NP_005944.1). Sequence MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA Gene ID Swiss Prot Synonyms MT2; MT-2; MT-II Calculated MW 6kDa Observed MW 15kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, U2OS, U-87MG, Mouse liver, Mouse testis, Mouse kidney Cellular location cytoplasm, cytosol, nucleus 
Western blot analysis of various lysates, using MT2A Rabbit pAb antibody (A22103) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts from wild type(WT) and MT2A Rabbit pAb knockdown (KD) 293T cells, using MT2A Rabbit pAb antibody (A22103) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-61 of human MT2A (NP_005944.1). Isotype IgG







