быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
14-3-3 Theta Rabbit pAb (A2563)
- Описание
- Характеристики
-
Overview
Product name 14-3-3 Theta Rabbit pAb Catalog No. A2563 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5' UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human 14-3-3 Theta (NP_006817.1). Sequence LLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAI Gene ID Swiss Prot Synonyms 1C5; HS1; 14-3-3 Calculated MW 28kDa Observed MW 32kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples SW480, BT-474, HeLa, Jurkat, Mouse liver, Mouse kidney, Mouse brain Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using 14-3-3 Theta antibody (A2563) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human 14-3-3 Theta (NP_006817.1). Isotype IgG