быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
A4GALT Rabbit pAb (A8817)
- Описание
- Характеристики
-
Overview
Product name A4GALT Rabbit pAb Catalog No. A8817 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system. This protein, a type II membrane protein found in the Golgi, is also required for the synthesis of the bacterial verotoxins receptor. Alternatively spliced transcript variants have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 244-353 of human A4GALT (NP_059132.1). Sequence WIWGHQGPQLLTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHEAMKMYL Gene ID Swiss Prot Synonyms P1; PK; Gb3S; P(k); P1PK; A14GALT; A4GALT1 Calculated MW 40kDa Observed MW 45kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, LO2, A375, HeLa, Mouse kidney, Mouse brain, Rat kidney Cellular location Golgi apparatus membrane, Single-pass type II membrane protein 
Western blot analysis of extracts of various cell lines, using A4GALT antibody (A8817) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 244-353 of human A4GALT (NP_059132.1). Isotype IgG