быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ABCB11 Rabbit pAb (A8467)
- Описание
- Характеристики
-
Overview
Product name ABCB11 Rabbit pAb Catalog No. A8467 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is the major canalicular bile salt export pump in man. Mutations in this gene cause a form of progressive familial intrahepatic cholestases which are a group of inherited disorders with severe cholestatic liver disease from early infancy.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1050-1150 of human ABCB11 (NP_003733.2). Sequence RFFQLLDRQPPISVYNTAGEKWDNFQGKIDFVDCKFTYPSRPDSQVLNGLSVSISPGQTLAFVGSSGCGKSTSIQLLERFYDPDQGKVMIDGHDSKKVNVQ Gene ID Swiss Prot Synonyms BSEP; PGY4; SPGP; ABC16; BRIC2; PFIC2; PFIC-2 Calculated MW 146kDa Observed MW 160kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse liver Cellular location Membrane, Multi-pass membrane protein Customer validation WB(Mus musculus)
Western blot analysis of extracts of Mouse liver, using ABCB11 antibody (A8467) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of NIH-3T3 cells using ABCB11 Polyclonal Antibody (A8467) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using ABCB11 antibody (A8467) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1050-1150 of human ABCB11 (NP_003733.2). Isotype IgG