быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
AARS Rabbit pAb (A7864)
- Описание
- Характеристики
-
Overview
Product name AARS Rabbit pAb Catalog No. A7864 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The human alanyl-tRNA synthetase (AARS) belongs to a family of tRNA synthases, of the class II enzymes. Class II tRNA synthases evolved early in evolution and are highly conserved. This is reflected by the fact that 498 of the 968-residue polypeptide human AARS shares 41% identity witht the E.coli protein. tRNA synthases are the enzymes that interpret the RNA code and attach specific aminoacids to the tRNAs that contain the cognate trinucleotide anticodons. They consist of a catalytic domain which interacts with the amino acid acceptor-T psi C helix of the tRNA, and a second domain which interacts with the rest of the tRNA structure.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human AARS (P49588). Sequence MDSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEM Gene ID Swiss Prot Synonyms AARS; TTD8; CMT2N; DEE29; HDLS2; EIEE29 Calculated MW 107kDa Observed MW 107kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, SW620, U-251MG, HeLa, MCF7, Mouse liver, Mouse brain, Rat spinal cord Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using AARS antibody (A7864) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human AARS (P49588). Isotype IgG