быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
AARS2 Rabbit pAb (A7826)
- Описание
- Характеристики
-
Overview
Product name AARS2 Rabbit pAb Catalog No. A7826 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene belongs to the class-II aminoacyl-tRNA synthetase family. Aminoacyl-tRNA synthetases play critical roles in mRNA translation by charging tRNAs with their cognate amino acids. The encoded protein is a mitochondrial enzyme that specifically aminoacylates alanyl-tRNA. Mutations in this gene are a cause of combined oxidative phosphorylation deficiency 8.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 841-985 of human AARS2 (NP_065796.1). Sequence RRELLATVKMLQRRANTAIRKLQMGQAAKKTQELLERHSKGPLIVDTVSAESLSVLVKVVRQLCEQAPSTSVLLLSPQPMGKVLCACQVAQGAMPTFTAEAWALAVCSHMGGKAWGSRVVAQGTGSTTDLEAALSIAQTYALSQL Gene ID Swiss Prot Synonyms AARSL; LKENP; COXPD8; MTALARS; MT-ALARS Calculated MW 107kDa Observed MW 107kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, SKOV3, U-251MG, MCF7 Cellular location Mitochondrion Customer validation WB(Homo sapiens)
IF(Homo sapiens)
Western blot analysis of extracts of various cell lines, using AARS2 antibody (A7826) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 841-985 of human AARS2 (NP_065796.1). Isotype IgG