быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
γ-Tubulin Rabbit pAb (A6215)
- Описание
- Характеристики
-
Overview
Product name γ-Tubulin Rabbit pAb Catalog No. A6215 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the tubulin superfamily. The encoded protein localizes to the centrosome where it binds to microtubules as part of a complex referred to as the gamma-tubulin ring complex. The protein mediates microtubule nucleation and is required for microtubule formation and progression of the cell cycle. A pseudogene of this gene is found on chromosome 7.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 382-451 of human γ-Tubulin (NP_001061.2). Sequence TSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ Gene ID Swiss Prot Synonyms TUBG; GCP-1; CDCBM4; TUBGCP1 Calculated MW 51kDa Observed MW 50kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples U2OS, HeLa, NIH/3T3, C2C12, Jurkat, C6, Mouse brain Cellular location Cytoplasm, centrosome, cytoskeleton, microtubule organizing center 
Western blot analysis of extracts of various cell lines, using γ-Tubulin antibody (A6215) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 382-451 of human γ-Tubulin (NP_001061.2). Isotype IgG