быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ZFAND5 Rabbit pAb (A13185)
- Описание
- Характеристики
-
Overview
Product name ZFAND5 Rabbit pAb Catalog No. A13185 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Predicted to enable DNA binding activity and zinc ion binding activity. Predicted to act upstream of or within several processes, including face development; fibroblast migration; and platelet-derived growth factor receptor signaling pathway. Predicted to be located in cytoplasm.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-150 of human ZFAND5 (NP_001095890.1). Sequence RQQNSGRMSPMGTASGSNSPTSDSASVQRADTSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEEKAPELPKPK Gene ID Swiss Prot Synonyms ZA20D2; ZNF216; ZFAND5A Calculated MW 23kDa Observed MW 23kDa Applications
Reactivity Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse eye Cellular location Cytoplasm 
Western blot analysis of extracts of mouse eye, using ZFAND5 Antibody (A13185) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-150 of human ZFAND5 (NP_001095890.1). Isotype IgG