быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
AATF Rabbit pAb (A5896)
- Описание
- Характеристики
-
Overview
Product name AATF Rabbit pAb Catalog No. A5896 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 7-100 of human AATF (NP_036270.1). Sequence LALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISD Gene ID Swiss Prot Synonyms DED; BFR2; CHE1; CHE-1 Calculated MW 63kDa Observed MW 80-90kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples RAW264.7, NIH/3T3, Neuro-2a Cellular location Nucleus, nucleolus 
Western blot analysis of various lysates, using AATF antibody (A5896) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 7-100 of human AATF (NP_036270.1). Isotype IgG