быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ZFP42 Rabbit pAb (A15954)
- Описание
- Характеристики
-
Overview
Product name ZFP42 Rabbit pAb Catalog No. A15954 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Enables sequence-specific double-stranded DNA binding activity. Involved in female gonad development and male gonad development. Located in cytoplasm.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ZFP42 (NP_777560.2). Sequence MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALCDGYVCYEPGPQALGGDDFSDCYIECVIRGEFSQPILEEDSLFESLEYLKKGSEQQLSQKVFEASSLECSLEYMKKGVKKELPQKIVGENS Gene ID Swiss Prot Synonyms REX1; REX-1; ZNF754; zfp-42 Calculated MW 35kDa Observed MW 35kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T Cellular location Nucleus 
Western blot analysis of extracts of 293T cells, using ZFP42 antibody (A15954) at 1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ZFP42 (NP_777560.2). Isotype IgG