быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ZNF766 Rabbit pAb (A15925)
- Описание
- Характеристики
-
Overview
Product name ZNF766 Rabbit pAb Catalog No. A15925 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Predicted to enable DNA binding activity and metal ion binding activity. Predicted to be involved in regulation of transcription, DNA-templated. Located in nucleus.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-190 of human ZNF766 (NP_001010851.1). Sequence MMKQRTEPWTVENEMKVAKNPDRWEGIKDINTGRSCAVRSKAGNKPITNQLGLTFQLPLPELEIFQGEGKIYECNQVQKFISHSSSVSPLQRIYSGVKTHIFNKHRNDFVDFPLLSQEQKAHIRRKPYECN Gene ID Swiss Prot Synonyms ZNF766 Calculated MW 55kDa Observed MW 60kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse kidney, Rat kidney Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using ZNF766 antibody (A15925) at 1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-190 of human ZNF766 (NP_001010851.1). Isotype IgG