быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ZNF134 Rabbit pAb (A15739)
- Описание
- Характеристики
-
Overview
Product name ZNF134 Rabbit pAb Catalog No. A15739 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Predicted to enable DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be active in nucleoplasm.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 73-170 of human ZNF134 (NP_003426.3). Sequence HGLKLHTCGACGRQFWFSANLHQYQKCYSIEQPLRRDKSEASIVKNCTVSKEPHPSEKPFTCKEEQKNFQATLGGCQQKAIHSKRKTHRSTESGDAFH Gene ID Swiss Prot Synonyms pHZ-15 Calculated MW 48kDa Observed MW 55kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293F, U-251MG Cellular location Nucleus 
Western blot analysis of various lysates, using ZNF134 Rabbit pAb (A15739) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 73-170 of human ZNF134 (NP_003426.3). Isotype IgG