быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ZSCAN21 Rabbit pAb (A15330)
- Описание
- Характеристики
-
Overview
Product name ZSCAN21 Rabbit pAb Catalog No. A15330 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Enables DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in positive regulation of transcription by RNA polymerase II. Predicted to be located in nucleus.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 130-280 of human ZSCAN21 (NP_666019.1). Sequence PGHQVSTPPNEQKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEAEGLKGDIISVIIANKPEASLERQCVNLENEKGTKPPLQEAGSKKGRESVPTKPTPGERRYICA Gene ID Swiss Prot Synonyms ZNF38; Zipro1; NY-REN-21 Calculated MW 54kDa Observed MW 54kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:200 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples MCF7, 293T, Mouse brain, Mouse heart, Rat brain, Rat heart Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using ZSCAN21 antibody (A15330) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 130-280 of human ZSCAN21 (NP_666019.1). Isotype IgG