быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SARS-CoV-2 Spike Rabbit pAb (A20137)
- Описание
- Характеристики
-
Overview
Product name SARS-CoV-2 Spike Rabbit pAb Catalog No. A20137 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ The structural proteins of SARS-CoV-2 include the envelope protein (E), spike or surface glycoprotein (S), membrane protein (M) and the nucleocapsid protein (N). The spike glycoprotein is found on the outside of the virus particle and gives coronavirus viruses their crown-like appearance. This glycoprotein mediates attachment of the virus particle and entry into the host cell. S protein is an important target for vaccine development, antibody therapies and diagnostic antigen-based tests.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-700 of coronavirus Spike (YP_009724390.1). Sequence PGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLG Gene ID Swiss Prot Synonyms spike glycoprotein Calculated MW 141kDa Observed MW 110kDa/180kDa Applications
Reactivity SARS-CoV-2 Tested applications WB IF/ICC IP DB Recommended dilution - DB 1:500 - 1:2000
- WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples 293T Cellular location Customer validation IF(Homo sapiens)
Western blot analysis of extracts of 293T and transfected 293T-S1（His-tag), using SARS-CoV-2 Spike antibody (A20137) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of 293T and transfected 293T-S ECD（His-tag), using SARS-CoV-2 Spike antibody (A20137) at 1:1000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immobilized Recombinant SARS-COV-2 S1+S2 ECD(S-ECD) Protein (RP01283) at 1μg/mL (100μL/well) can bind SARS-CoV-2 Spike Rabbit pAb (A20137) with a linear range of 0.78-50ng/mL.
Immunofluorescence analysis of 293T cells transfected with SARS-CoV-2 Spike protein and untreated 293T cells use SARS-CoV-2 Spike Rabbit pAb (A20137) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg SARS-CoV-2 Spike antibody (A20137). Western blot was performed from the immunoprecipitate using SARS-CoV-2 Spike antibody (A20137) at a dilution of 1:1000.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity SARS-CoV-2 Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-700 of coronavirus Spike (YP_009724390.1). Isotype IgG