быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SARS-CoV-2 ORF9b Rabbit pAb (A20260)
- Описание
- Характеристики
-
Overview
Product name SARS-CoV-2 ORF9b Rabbit pAb Catalog No. A20260 Host species Rabbit Purification method Affinity purification Isotype IgG Background
SARS-CoV-2 (severe acute respiratory syndrome coronavirus 2) is the causative agent of the COVID19 pandemic.?? SARS-CoV-2 and SARS-CoVshare many proteins common in other CoVs, including 4 majorstructural proteins (S, E, M, and N proteins) and 16 nonstructuralproteins (nsp1-16), they possess a unique set of proteins, namelyorf3a, 3b, 6, 7a, 7b, 8a, 8b, and 9b。The SARS-CoV-2 genome encodes for a small accessory protein termed Orf9b, ?? which targets the mitochondrial outer membrane protein TOM70 in infected cells.This 98-amino acid (aa) protein is encoded by analternative open reading frame (ORF) within the N gene and istranslated via a leaky scanning mechanism during translationCrystal structures of orf9b alone revealed a homodimericβ-strand-rich structure? with a hydro_x005fphobic central tunnel for lipid binding, consistent with the role oforf9b in the mature virion assemblyImmunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of coronavirus ORF9b (P0DTD2). Sequence MDPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK Gene ID Swiss Prot Synonyms Calculated MW 11kDa Observed MW 12-14kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T Cellular location Customer validation WB(Homo sapiens)
Western blot analysis of extracts of normal 293T cells 293T transfected with ORF9b Protein, using SARS-CoV-2 ORF9b antibody (A20260) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of coronavirus ORF9b (P0DTD2). Isotype IgG