быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SARS-CoV-2 ORF7a Rabbit pAb (A20307)
- Описание
- Характеристики
-
Overview
Product name SARS-CoV-2 ORF7a Rabbit pAb Catalog No. A20307 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF7a encodes a viral accessory protein. Based on its similarity to other coronavirus proteins, ORF7a protein is thought to be a type I transmembrane protein.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 16-98 of coronavirus ORF7a (YP_009724395.1). Sequence ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYS Gene ID Swiss Prot Synonyms Calculated MW 14kDa Observed MW 17kDa Applications
Reactivity SARS-CoV-2 Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T Cellular location 
Western blot analysis of extracts of normal 293T cells and 293T transfected with ORF7a Protein, using SARS-CoV-2 ORF7a antibody (A20307) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity SARS-CoV-2 Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 16-98 of coronavirus ORF7a (YP_009724395.1). Isotype IgG