быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SARS-CoV-2 ORF6 Rabbit pAb (A20324)
- Описание
- Характеристики
-
Overview
Product name SARS-CoV-2 ORF6 Rabbit pAb Catalog No. A20324 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF6 encodes a viral accessory protein. Based on its similarity to other coronavirus proteins, ORF6 protein is thought to play a role in viral pathogenesis.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-61 of coronavirus ORF6 (YP_009724394.1). Sequence MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID Gene ID Swiss Prot Synonyms Calculated MW 7kDa Observed MW 12kDa Applications
Reactivity SARS-CoV-2 Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T Cellular location 
Western blot analysis of extracts of 293T cells, using SARS-CoV-2 ORF6 antibody (A20324) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity SARS-CoV-2 Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-61 of coronavirus ORF6 (YP_009724394.1). Isotype IgG