быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
β-Tubulin Rabbit mAb (A12289)
- Описание
- Характеристики
-
Overview
Product name β-Tubulin Rabbit mAb Catalog No. A12289 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0203 Background
This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human β-Tubulin (P07437). Sequence LRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK Gene ID Swiss Prot Synonyms M40; TUBB1; TUBB5; CDCBM6; CSCSC1; OK/SW-cl.56 Calculated MW 50kDa Observed MW 55kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC IP Recommended dilution - WB 1:5000 - 1:10000
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples 293F, SH-SY5Y, Mouse Brain, Mouse Thymus, Rat Brain Cellular location Cytoplasm, cytoskeleton Customer validation WB(Mus musculus, Rattus norvegicus, Homo sapiens, Crassostrea gigas, Chlorocebus aethiops )
WB (Mus musculus)
IHC(Mus musculus)
Western blot analysis of extracts of various cell lines, using β-Tubulin Rabbit mAb (A12289) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
Western blot analysis of 293F cells, using β-Tubulin Rabbit mAb (A12289) at 1:1000-1:30000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of C6 cells using β-Tubulin antibody (A12289) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using β-Tubulin antibody (A12289) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using β-Tubulin antibody (A12289) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg β-Tubulin antibody (A12289). Western blot was performed from the immunoprecipitate using β-Tubulin antibody (A12289) at a dilution of 1:1000.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Tag and Loading Control Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human β-Tubulin (P07437). Isotype IgG