быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ZNF699 Rabbit pAb (A14466)
- Описание
-
Overview
Product name ZNF699 Rabbit pAb Catalog No. A14466 Host species Rabbit Purification method Affinity purification Isotype IgG Background
May be involved in transcriptional regulation.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-200 of human ZNF699 (NP_940937.1). Sequence QRNLYRDVMLENFQNLASLGYPLHTPHLISQWEQEEDLQTVKRELIQGIFMGEHREGFETQLKTNESVASQDICGEKISNEQKIVRFKRNDSWFSSLHENQESCGIDYQNKSHERHLRNHMVENIYECYEENQDGQTFSQVPNLDSLKRNTEVKSCECHEC Gene ID Swiss Prot Synonyms ZNF699; hang Calculated MW 73kDa Observed MW 74kDa Applications
Reactivity Human Tested applications WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP Recommended dilution WB 1:500 - 1:2000 Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Positive samples K-562, U-87MG Cellular location Nucleus ZNF699 Rabbit pAb images
Western blot - ZNF699 Polyclonal Antibody (A14466)
Western blot analysis of extracts of various cell lines, using ZNF699 antibody (A14466) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.* For research use only. Not for therapeutic or diagnostic purposes.
Product Protocols