быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ZNF641 Rabbit pAb (A14438)
- Описание
-
Overview
Product name ZNF641 Rabbit pAb Catalog No. A14438 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Transcriptional activator. Activates transcriptional activities of SRE and AP-1.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-260 of human ZNF641 (NP_689533.2). Sequence LLAAGSQGLVTIKDVSLCFSQEEWRSLDPSQTDFYGEYVMQENCGIVVSLRFPIPKLDMLSQLEGGEEQWVPDPQDLEERDILRVTYTGDGSEHEGDTPELEAEPPRMLSSVSEDTVLWNPEHDESWDSMPSSSRGMLLGPPFLQEDSFSNLLCSTEMDSL Gene ID Swiss Prot Synonyms ZNF641 Calculated MW 43kDa/46kDa/48kDa/49kDa Observed MW 49kDa Applications
Reactivity Human, Mouse Tested applications WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP Recommended dilution WB 1:500 - 1:2000 Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, A-549, HeLa, Mouse heart Cellular location Nucleus ZNF641 Rabbit pAb images
Western blot - ZNF641 Polyclonal Antibody (A14438)
Western blot analysis of extracts of various cell lines, using ZNF641 antibody (A14438) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.* For research use only. Not for therapeutic or diagnostic purposes.
Product Protocols