быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ZNF707 Rabbit pAb (A13737)
- Описание
-
Overview
Product name ZNF707 Rabbit pAb Catalog No. A13737 Host species Rabbit Purification method Affinity purification Isotype IgG Background
May be involved in transcriptional regulation.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-180 of human ZNF707 (NP_776192.2). Sequence CSPRPDLVSRLEQWEEPWVEDRERPEFQAVQRGPRPGARKSADPKRPCDHPAWAHKKTHVRRERAREGSSFRKGFRLDTDDGQLPRAAPERTDAKPTAFPCQVLTQRCGRRPGRRERRKQRAVELSFICGT Gene ID Swiss Prot Synonyms ZNF707 Calculated MW 43kDa Observed MW Refer to figures Applications
Reactivity Human, Mouse, Rat Tested applications WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP Recommended dilution WB 1:500 - 1:2000
IHC 1:50 - 1:200
IF 1:50 - 1:200Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples Cellular location Nucleus ZNF707 Rabbit pAb images
Immunohistochemistry - ZNF707 Polyclonal Antibody (A13737)
Immunohistochemistry of paraffin-embedded human lung cancer using ZNF707 antibody (A13737) at dilution of 1:100 (40x lens).
Immunohistochemistry - ZNF707 Polyclonal Antibody (A13737)
Immunohistochemistry of paraffin-embedded human liver using ZNF707 antibody (A13737) at dilution of 1:100 (40x lens).
Immunohistochemistry - ZNF707 Polyclonal Antibody (A13737)
Immunohistochemistry of paraffin-embedded human gastric cancer using ZNF707 antibody (A13737) at dilution of 1:100 (40x lens).* For research use only. Not for therapeutic or diagnostic purposes.
Product Protocols