быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ZNF574 Rabbit pAb (A14923)
- Описание
-
Overview
Product name ZNF574 Rabbit pAb Catalog No. A14923 Host species Rabbit Purification method Affinity purification Isotype IgG Background
May be involved in transcriptional regulation.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 170-310 of human ZNF574 (NP_073589.4). Sequence PPVGQARVAVEHSYRKAEEGGEGATVPSAAATTTEVVTEVELLLYKCSECSQLFQLPADFLEHQATHFPAPVPESQEPALQQEVQASSPAEVPVSQPDPLPASDHSYELRNGEAIGRDRRGRRARRNNSGEAGGAATQELF Gene ID Swiss Prot Synonyms ZNF574; FP972 Calculated MW 98kDa/108kDa Observed MW Applications
Reactivity Human, Mouse, Rat Tested applications WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP Recommended dilution IHC 1:50 - 1:200
IF 1:50 - 1:200Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Immunohistochemistry Immunofluorescence Positive samples Cellular location Nucleus ZNF574 Rabbit pAb images
Immunohistochemistry - ZNF574 Rabbit pAb (A14923)
Immunohistochemistry of paraffin-embedded human stomach using ZNF574 antibody (A14923) at dilution of 1:100 (40x lens).
Immunohistochemistry - ZNF574 Rabbit pAb (A14923)
Immunohistochemistry of paraffin-embedded mouse pancreas using ZNF574 antibody (A14923) at dilution of 1:100 (40x lens).
Immunofluorescence - ZNF574 Rabbit pAb (A14923)
Immunofluorescence analysis of NIH-3T3 cells using ZNF574 antibody (A14923) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence - ZNF574 Rabbit pAb (A14923)
Immunofluorescence analysis of U-2 OS cells using ZNF574 antibody (A14923) at dilution of 1:100. Blue: DAPI for nuclear staining.* For research use only. Not for therapeutic or diagnostic purposes.
Product Protocols