быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ZNF557 Rabbit pAb (A18490)
- Описание
-
Overview
Product name ZNF557 Rabbit pAb Catalog No. A18490 Host species Rabbit Purification method Affinity purification Isotype IgG Background
May be involved in transcriptional regulation.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human ZNF557 (NP_077317.2). Sequence MAAVVLPPTAALSSLFPASQREGHTEGGELVNELLKSWLKGLVTFEDVAVEFTQEEWALLDPAQRTLYRDVMLENCRNLASLGNQVDKPRLISQLEQEDKVMTEERGILSGTCPDVENPFKAKGLTPKLHVFRKEQSRNMKMERNHLGAT Gene ID Swiss Prot Synonyms ZNF557 Calculated MW Observed MW 49kDa Applications
Reactivity Human, Mouse, Rat Tested applications WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP Recommended dilution WB 1:500 - 1:2000 Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, A-549, 293T, Mouse lung, Mouse brain, Rat lung Cellular location ZNF557 Rabbit pAb images
Western blot - ZNF557 Rabbit pAb (A18490)
Western blot analysis of extracts of various cell lines, using ZNF557 Rabbit pAb (A18490) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.* For research use only. Not for therapeutic or diagnostic purposes.
Product Protocols