![[KO Validated] SEC61B Rabbit pAb (A15788)](/upload/resize_cache/iblock/214/340_340_140cd750bba9870f18aada2478b24840a/jio0wnyaiv8p6ms7k6745qlj1b15m5bd.jpg "[KO Validated] SEC61B Rabbit pAb (A15788)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] SEC61B Rabbit pAb (A15788)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] SEC61B Rabbit pAb Catalog No. A15788 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins- alpha, beta, and gamma. This gene encodes the beta-subunit protein. The Sec61 subunits are also observed in the post-ER compartment, suggesting that these proteins can escape the ER and recycle back. There is evidence for multiple polyadenylated sites for this transcript.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-96 of human SEC61B (NP_006799.1). Sequence MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS Gene ID Swiss Prot Synonyms SEC61B Calculated MW 10kDa Observed MW 12kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, HepG2, SH-SY5Y, Mouse stomach, Rat liver, Rat stomach Cellular location Endoplasmic reticulum membrane, Single-pass membrane protein Customer validation WB(Chlorocebus aethiops )
Western blot analysis of extracts from normal (control) and SEC61B knockout (KO) 293T cells, using SEC61B antibody (A15788) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of L929 cells using SEC61B antibody (A15788) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-96 of human SEC61B (NP_006799.1). KO Validated Validated Isotype IgG