![[KO Validated] TOM20 Rabbit pAb (A16896)](/upload/resize_cache/iblock/92a/340_340_140cd750bba9870f18aada2478b24840a/ouc0yvoyik2y02shqxpskkrzh4dqhasy.jpg "[KO Validated] TOM20 Rabbit pAb (A16896)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] TOM20 Rabbit pAb (A16896)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] TOM20 Rabbit pAb Catalog No. A16896 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Enables protein-transporting ATPase activity and unfolded protein binding activity. Involved in protein targeting to mitochondrion. Located in mitochondria-associated endoplasmic reticulum membrane and mitochondrial outer membrane.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human TOM20 (NP_055580.1). Sequence YCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE Gene ID Swiss Prot Synonyms MAS20; MOM19; TOM20 Calculated MW 16kDa Observed MW 16kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples 293T, THP-1, MCF7, mouse liver, mouse kidney, mouse brain, rat thymus Cellular location Mitochondrion outer membrane, Single-pass membrane protein Customer validation WB(Mus musculus, Homo sapiens)
IF(Homo sapiens)
Western blot analysis of extracts of various cell lines, using TOM20 antibody (A16896) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.
Western blot analysis of extracts from normal (control) and TOM20 knockout (KO) 293T cells, using TOM20 antibody (A16896) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using [KO Validated] TOM20 Rabbit pAb (A16896) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse heart using [KO Validated] TOM20 Rabbit pAb (A16896) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat kidney using [KO Validated] TOM20 Rabbit pAb (A16896) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of C6 cells using TOM20 antibody (A16896) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 using TOM20 antibody (A16896) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using TOM20 antibody (A16896) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human TOM20 (NP_055580.1). KO Validated Validated Isotype IgG