![[KO Validated] Rig-I/DDX58 Rabbit pAb (A18003)](/upload/resize_cache/iblock/b0c/340_340_140cd750bba9870f18aada2478b24840a/g9bmjbu4ip3fcxqegbzkrkbyr6akapgi.jpg "[KO Validated] Rig-I/DDX58 Rabbit pAb (A18003)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] Rig-I/DDX58 Rabbit pAb (A18003)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] Rig-I/DDX58 Rabbit pAb Catalog No. A18003 Host species Rabbit Purification method Affinity purification Isotype IgG Background
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure. This gene encodes a protein containing RNA helicase-DEAD box protein motifs and a caspase recruitment domain (CARD). It is involved in viral double-stranded (ds) RNA recognition and the regulation of the antiviral innate immune response. Mutations in this gene are associated with Singleton-Merten syndrome 2.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 830 to the C-terminus of human Rig-I/DDX58 (NP_055129.2). Sequence HYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSK Gene ID Swiss Prot Synonyms RIG1; DDX58; RIG-I; RLR-1; SGMRT2 Calculated MW 107kDa Observed MW 102kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:20 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples A-549 Cellular location Cell junction, Cell projection, Cytoplasm, cytoskeleton, ruffle membrane, tight junction 
Western blot analysis of extracts from normal (control) and Rig-I/DDX58 knockout (KO) A-549 cells, using Rig-I/DDX58 antibody (A18003) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min. -
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 830 to the C-terminus of human Rig-I/DDX58 (NP_055129.2). KO Validated Validated Isotype IgG