![[KO Validated] TOM20 Rabbit pAb (A18047)](/upload/resize_cache/iblock/d2c/340_340_140cd750bba9870f18aada2478b24840a/26a711uibq8occx3qeemo2y8l6xjh4ek.jpg "[KO Validated] TOM20 Rabbit pAb (A18047)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] TOM20 Rabbit pAb (A18047)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] TOM20 Rabbit pAb Catalog No. A18047 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Enables protein-transporting ATPase activity and unfolded protein binding activity. Involved in protein targeting to mitochondrion. Located in mitochondria-associated endoplasmic reticulum membrane and mitochondrial outer membrane.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human TOMM20 (NP_055580.1). Sequence MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE Gene ID Swiss Prot Synonyms MAS20; MOM19; TOM20 Calculated MW 16kDa Observed MW 16kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:1000 - 1:5000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, THP-1, 293T, Mouse liver, Mouse brain, Rat kidney Cellular location Mitochondrion outer membrane, Single-pass membrane protein Customer validation IF(Mus musculus)
Western blot analysis of extracts of various cell lines, using TOM20 antibody (A18047) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using TOM20 antibody (A18047) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts from normal (control) and TOM20 knockout (KO) 293T cells, using TOM20 antibody (A18047) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of C6 cells using [KO Validated] TOM20 Rabbit pAb (A18047) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] TOM20 Rabbit pAb (A18047) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using [KO Validated] TOM20 Rabbit pAb (A18047) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human TOMM20 (NP_055580.1). KO Validated Validated Isotype IgG