![[KO Validated] α-Catenin Rabbit mAb (A19004)](/upload/resize_cache/iblock/384/340_340_140cd750bba9870f18aada2478b24840a/kd0xu2iwgpr3cnvtan7msqdr3lrd1t16.jpg "[KO Validated] α-Catenin Rabbit mAb (A19004)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] α-Catenin Rabbit mAb (A19004)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] α-Catenin Rabbit mAb Catalog No. A19004 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0348 Background
This gene encodes a member of the catenin family of proteins that play an important role in cell adhesion process by connecting cadherins located on the plasma membrane to the actin filaments inside the cell. The encoded mechanosensing protein contains three vinculin homology domains and undergoes conformational changes in response to cytoskeletal tension, resulting in the reconfiguration of cadherin-actin filament connections. Certain mutations in this gene cause butterfly-shaped pigment dystrophy.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human α-Catenin (P35221). Sequence MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHVLAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQ Gene ID Swiss Prot Synonyms MDBS2; MDPT2; CAP102 Calculated MW 100kDa Observed MW 100kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HCT116, NIH/3T3, Mouse lung, Rat heart, 293T（WT） Cellular location Cell junction, Cell junction, Cell membrane, Cytoplasm, Cytoplasmic side, Peripheral membrane protein, adherens junction, cytoskeleton Customer validation WB(Mus musculus)
Western blot analysis of extracts from wild type (WT) and α-Catenin knockout (KO) 293T cells, using α-Catenin antibody (A19004) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using α-Catenin antibody (A19004) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human α-Catenin (P35221). KO Validated Validated Isotype IgG