+7-495-308-45-67 Заказать звонок

[KO Validated] YAP1 Rabbit mAb (A19134)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] YAP1 Rabbit mAb
Catalog No.	A19134
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC53477

Background

This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1).
Sequence	PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Gene ID
Swiss Prot
Synonyms	YAP; YKI; COB1; YAP2; YAP-1; YAP65
Calculated MW	36kDa/48kDa/49kDa/50kDa/52kDa/53kDa/54kDa
Observed MW	72kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP
Recommended dilution	WB 1:2000 - 1:4000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	HeLa, Mouse heart, C6
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Homo sapiens, Mus musculus) IHC(Homo sapiens) IF(Mus musculus)

Western blot analysis of extracts of C6 cells, using YAP1 antibody (A19134) at1:4000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of extracts of Mouse heart, using YAP1 antibody (A19134) at1:4000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

Western blot analysis of extracts from wild type(WT) and YAP1 knockout (KO) HeLa cells, using YAP1 antibody (A19134) at1:4000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using YAP1 antibody (A19134) at dilution of 1:200(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human liver cancer using YAP1 antibody (A19134) at dilution of 1:200(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human colon (low expression samples) using YAP1 antibody (A19134) at dilution of 1:200(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunofluorescence analysis of NIH/3T3 cells using YAP1 antibody (A19134) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U20S cells using YAP1 antibody (A19134) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using YAP1 antibody (A19134) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunoprecipitation analysis of 300 μg extracts of A-549 cells using 3 μg YAP1 antibody (A19134). Western blot was performed from the immunoprecipitate using YAP1 antibody (A19134) at a dilution of 1:500.

Key applications	Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1).
KO Validated	Validated
Isotype	IgG