[KO Validated] TXLNA Rabbit pAb (A19889)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] TXLNA Rabbit pAb
Catalog No.	A19889
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable syntaxin binding activity. Predicted to be involved in exocytosis. Predicted to act upstream of or within B cell activation. Located in cytoplasm.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TXLNA (NP_787048.1).
Sequence	MKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDPNTEEIRQSDEVGDRDHRRPQ
Gene ID
Swiss Prot
Synonyms	IL14; TXLN
Calculated MW	62kDa
Observed MW	80kDa

Applications

Reactivity	Human
Tested applications	WB
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa
Cellular location	cytoplasm, cytosol, extracellular region

Western blot analysis of extracts from normal (control) and TXLNA knockout (KO) HeLa cells, using TXLNA antibody (A19889) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Key applications	Western blotting
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TXLNA (NP_787048.1).
KO Validated	Validated
Isotype	IgG